Protein Info for MPMX19_01772 in Azospirillum sp. SherDot2

Annotation: putative inner membrane transporter YedA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 261 to 277 (17 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details PF00892: EamA" amino acids 21 to 152 (132 residues), 74.7 bits, see alignment E=4.7e-25 amino acids 169 to 298 (130 residues), 48.4 bits, see alignment E=6e-17

Best Hits

KEGG orthology group: None (inferred from 71% identity to smk:Sinme_3077)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MPMX19_01772 putative inner membrane transporter YedA (Azospirillum sp. SherDot2)
MTSLPAPDARASRPDLRVELALLLALATLWGASYSFIRIGVETIPPLTFIAGRTLIAGGI
LLAVIRWRGLSLPREGAVWKRFLLQACLNSVLPFTLIAWAEQTVDAGSAAILNATTPIFA
FLITLLLTRHEAVGWRKAVGVFAGLGGTVLIIGIGAVDGIGRDLLAQGAIVLATVCYAGA
AIFGRVFKGLDPIMPAAGSLLCGAALLLPVSVAVDRPWTLSPSPDSLLALAGLSVFSTAL
AFVLYFRLVHTIGSVPTTAQAYLRVPIGVGIGVLMLGETLEPTMLAGCAAVVLGVAAMTI
PARSRS