Protein Info for MPMX19_01767 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 3 to 162 (160 residues), 203.2 bits, see alignment E=1.7e-64 PF03350: UPF0114" amino acids 10 to 126 (117 residues), 137.9 bits, see alignment E=9.2e-45

Best Hits

Swiss-Prot: 50% identical to Y4083_AZOVD: UPF0114 protein Avin_40830 (Avin_40830) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: None (inferred from 89% identity to azl:AZL_021630)

Predicted SEED Role

"Uncharacterized protein UPF0114"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>MPMX19_01767 hypothetical protein (Azospirillum sp. SherDot2)
MIERRFEQIIFASRWLLAPFYLGLVVSLAALLVKFTQEILHMIPQVLEMSEKDVLLGVLT
LIDLSFAGNLLLMVIFAGYENFVSKIDVANHEDRPDWMGKVDFGGLKLKLIASIVAISGI
HLLKAFMNLAQTSRDELMWLVIIHMTFVISGVLLACMDRLEGHHGHATKPAEKAGAKPAA
DHH