Protein Info for MPMX19_01746 in Azospirillum sp. SherDot2

Annotation: NAD(P)H-quinone oxidoreductase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details PF00507: Oxidored_q4" amino acids 24 to 121 (98 residues), 141.7 bits, see alignment E=3.8e-46

Best Hits

Swiss-Prot: 69% identical to NU3M_TETSU: NADH-ubiquinone oxidoreductase chain 3 (ND3) from Tetraselmis subcordiformis

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 98% identity to azl:AZL_021480)

MetaCyc: 42% identical to ferredoxin-plastoquinone oxidoreductase subunit C (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>MPMX19_01746 NAD(P)H-quinone oxidoreductase subunit 3 (Azospirillum sp. SherDot2)
MSTPLIIEYLPILVFLLIGIALAAVMVGASYVISPKNPDAEKVSPYECGFEPFEDARTKF
DVRFYLVSILFIIFDLEVAFLFPWAVALGDIGLFGFWSMMLFLGILTIGFIYEWKKGALE
WE