Protein Info for MPMX19_01736 in Azospirillum sp. SherDot2

Annotation: NADH-quinone oxidoreductase subunit K

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 55 (24 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details PF00420: Oxidored_q2" amino acids 7 to 102 (96 residues), 104.7 bits, see alignment E=9.2e-35

Best Hits

Swiss-Prot: 78% identical to NUOK_BRASB: NADH-quinone oxidoreductase subunit K (nuoK) from Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 98% identity to azl:AZL_021380)

MetaCyc: 44% identical to ferredoxin-menaquinone dehydrogenase subunit K (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>MPMX19_01736 NADH-quinone oxidoreductase subunit K (Azospirillum sp. SherDot2)
MEIGLGHYLTVSAIIFTLGVLGIFLNRKNVIIILMSIEMMLLAVNLNLVAFSTFLHDLVG
QIFAMIILTVAAAEAAIGLAILVVYFRNRGSIRVEDINMMKG