Protein Info for MPMX19_01732 in Azospirillum sp. SherDot2

Annotation: Bifunctional ligase/repressor BirA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 20 to 256 (237 residues), 149.7 bits, see alignment E=5.2e-48 PF03099: BPL_LplA_LipB" amino acids 26 to 150 (125 residues), 75.1 bits, see alignment E=7.5e-25 PF16917: BPL_LplA_LipB_2" amino acids 70 to 206 (137 residues), 58.9 bits, see alignment E=7.6e-20 PF02237: BPL_C" amino acids 212 to 258 (47 residues), 31.3 bits, see alignment 2.4e-11

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 93% identity to azl:AZL_021340)

Predicted SEED Role

"Biotin--protein ligase (EC 6.3.4.9, EC 6.3.4.10, EC 6.3.4.11, EC 6.3.4.15)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>MPMX19_01732 Bifunctional ligase/repressor BirA (Azospirillum sp. SherDot2)
MTSSLEAEAARLRLPPGFQIKAFDSVGSTNDEAKALSRSGAPEGTVVWARRQESGRGRRG
RAWTSPEGNLYSTTILRPGLPPAEAAQVSFVAALAIAETAESVLPDPGGVRCKWPNDVLV
HDRKLSGILLESEPAPDGKVAWVVLGVGINLRHFPPTADYGATSLIAEGAPPMGPGALLE
VYAEHLAAWYGRWRAHGFGPVRDAWMSRAKGLGGPILVRLADRTIPGTFADLDSDGVLLL
DPTDGGPRQRIAAGDVFFAPPPADPRSPDS