Protein Info for MPMX19_01720 in Azospirillum sp. SherDot2

Annotation: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF00857: Isochorismatase" amino acids 8 to 183 (176 residues), 112.6 bits, see alignment E=1.2e-36

Best Hits

Swiss-Prot: 54% identical to Y2328_HALVD: Uncharacterized isochorismatase family protein HVO_2328 (HVO_2328) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K05993, isochorismatase [EC: 3.3.2.1] (inferred from 83% identity to azl:AZL_021190)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>MPMX19_01720 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (Azospirillum sp. SherDot2)
MEKLPSNAALLIIDLQKAIDDPRWSLTGPRNNPQAEANVAALLAAWRRDGRPIVHIRHDS
VEPDSSYRPGGPGHPFKEEARPLPGETVIGKRVNSAFIGTGLDEWLRDRGIARLVVAGVI
TNNSVEATVRMAGNLGYDVRLVADACFTFARKDRSGRLRTADEVHDLSLANMDGEYATVV
DTAAVLG