Protein Info for MPMX19_01682 in Azospirillum sp. SherDot2

Annotation: D-alanine--D-alanine ligase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01820: Dala_Dala_lig_N
  • amino acids 12 to 53 (42 residues), 36.6 bits, 8.7e-13
  • amino acids 65 to 95 (31 residues), 41.2 bits, see alignment (E = 3.5e-14)
• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 12 to 310 (299 residues), 266.2 bits, E=1.7e-83
• PF02655: ATP-grasp_3
  • amino acids 107 to 278 (172 residues), 33 bits, E=9.8e-12
• PF07478: Dala_Dala_lig_C
  • amino acids 143 to 308 (166 residues), 127.9 bits, E=5.9e-41

Best Hits

Swiss-Prot: 57% identical to DDL_CHESB: D-alanine--D-alanine ligase (ddl) from Chelativorans sp. (strain BNC1)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 93% identity to azl:AZL_020850)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Protein Sequence (315 amino acids)

>MPMX19_01682 D-alanine--D-alanine ligase B (Azospirillum sp. SherDot2)
MTEALLHAHKKHVAVLMGGWSAEREVSLVSGAGVAKALEEEGYRVTAIDVQRDLGGLMHA
LSTPRPDVVFNALHGRGGEDGTIQGVLEFLGLPYTHSGVQAAAISMDKAMTKRVLDTVGV
RSPKGMVLSRGEITGGSHPMPAPYIVKPVDEGSTVGVTLVREGQNSPVGDAWTFGERALI
EEFIPGRELTVGVMGDRALAVTEIVFQAQLYDYTAKYSAGHAVHTVPAAIPEVVADEAKR
LAVLAHNTLGCRGVSRSDFRWDDSRPGTDGLYFLEINNQPGMTPLSLVPEQAAHVGITYG
ALVGWLVENAACQLA