Protein Info for MPMX19_01681 in Azospirillum sp. SherDot2

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 31 to 306 (276 residues), 169.6 bits, see alignment E=4.6e-54 PF01565: FAD_binding_4" amino acids 44 to 172 (129 residues), 69.7 bits, see alignment E=2.2e-23 PF02873: MurB_C" amino acids 206 to 305 (100 residues), 117.5 bits, see alignment E=2.6e-38

Best Hits

Swiss-Prot: 67% identical to MURB_PARL1: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 89% identity to azl:AZL_020840)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>MPMX19_01681 UDP-N-acetylenolpyruvoylglucosamine reductase (Azospirillum sp. SherDot2)
MTAAPGMTASEGHLIERMPVVRGRLTADAPLAPVTWFRVGGPAEVMFRPANADDLADFLA
ALPAEVPVTVIGVASNLLVRDGGVPGVTIRLGRGFTDIAADGMTVTAGAAALDLNVAMVA
RDAGIAGLEFLSGIPGTIGGALRMNGGAYGRELADVLVSATAVARDGRRLEFSHAGMGFT
YRHSTAPEGCIFTGAVLRGEPGNPLEIARRMAEISDKRADSQPVRSRTGGSTFKNPEGHK
AWELIDKAGCRGLSIGDAQVSEKHCNFLINNGTATAAQLEALGEEVRRRVFETSGVTLDW
EIKRIGVPAEGSTAP