Protein Info for MPMX19_01680 in Azospirillum sp. SherDot2

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 10 to 108 (99 residues), 115.1 bits, E=2.3e-37
• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 11 to 459 (449 residues), 518.5 bits, E=8.7e-160
• PF08245: Mur_ligase_M
  • amino acids 113 to 298 (186 residues), 90 bits, E=3.1e-29
• PF02875: Mur_ligase_C
  • amino acids 321 to 451 (131 residues), 75.8 bits, E=8.4e-25

Best Hits

Swiss-Prot: 75% identical to MURC_RHOCS: UDP-N-acetylmuramate--L-alanine ligase (murC) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 98% identity to azl:AZL_020830)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Protein Sequence (472 amino acids)

>MPMX19_01680 UDP-N-acetylmuramate--L-alanine ligase (Azospirillum sp. SherDot2)
MRALPLSIGTIHFVGIGGIGMSGIAEVLRNLGYTVQGSDLAENANVKRLRELGIKVFVGH
RGENIAGAAVVVVSSAVKRDNPEVVAARAALVPVVRRAEMLGELMRLKWAIAIGGTHGKT
TTTSMVGHMLEHANLDPTVINGGIINAYGSNTRLGTGDWMVVEADESDGTFVKLPACIAV
VTNMDPEHLDFYGTFDNARAAFDSFVQNIPFYGFAALCIDHPEVQAMIPRVSDRRIVTYG
FSPQADIRAVNVELGPDGAKYDVLIYDRHTGESRAIAGVRLPMYGPHNVQNSLACFAVGN
EMGLPDVVMRDSMAKFQGVKRRFTKTGETNGITVIDDYGHHPVEIAAVLKAARTAGTGRT
IAVVQPHRYSRLAALFEEFCTCFNDADAVIVADVYAAGEAPIEGVSRDSLVEGLRMHGHR
HVVALHGQQELAQVVREMAKPGDFVVCLGAGNITQWANALPGELASLYGATR