Protein Info for MPMX19_01676 in Azospirillum sp. SherDot2

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07991: KARI_N
  • amino acids 7 to 61 (55 residues), 28.2 bits, 2.7e-10
• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 12 to 454 (443 residues), 362.8 bits, E=1.6e-112
• PF21799: MurD-like_N
  • amino acids 12 to 95 (84 residues), 31.9 bits, E=2.7e-11
• PF08245: Mur_ligase_M
  • amino acids 115 to 296 (182 residues), 97.9 bits, E=1.6e-31
• PF02875: Mur_ligase_C
  • amino acids 319 to 434 (116 residues), 33.3 bits, E=1.7e-11

Best Hits

Swiss-Prot: 54% identical to MURD_MAGSA: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 90% identity to azl:AZL_020800)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Protein Sequence (473 amino acids)

>MPMX19_01676 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Azospirillum sp. SherDot2)
MIDLFYMQELPVAVMGLGKSGLATARALRDSGAEVRVWDDNPASRAAAEAEGFAVVDLAS
ADLSDLTTIVWSPGIPHTHPKPHPVAERARALGIELICDIELLGRAERDCAFIGITGTNG
KSTTTTLIGHILAAAGRKAAVGGNLGTPVLTFDPIGSGGTCVLEMSSYQLELTHSITFDI
AVLLNITPDHLARHGGMEGYIAAKRLIFHRQTWPRTAVIGVDDEHCRKIHADLVAAGDQR
IWPISAQGPVAGGVYAADGWLVDDTDGEAAKVVELSGLPSLLGAHNWQNAAAAFATCKAA
GLPVPAIVAAMATFPGLAHRQQLVGTASGVRFVNDSKATNADATEKALATFDPIYWILGG
QAKDTGLNGLEGYMGRVRHAFLIGEAQEQFAAWLDAHGVAYTRCGTLDVATAKAAGLALA
ERLEGACVLLSPACASWDQFASFEKRGEAFAVYVANIVAAHESTGDGTSGGVA