Protein Info for MPMX19_01642 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 174 to 203 (30 residues), see Phobius details amino acids 211 to 216 (6 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 6 to 298 (293 residues), 223.4 bits, see alignment E=2.7e-70 PF02690: Na_Pi_cotrans" amino acids 16 to 150 (135 residues), 124.8 bits, see alignment E=2.6e-40 amino acids 162 to 228 (67 residues), 36.5 bits, see alignment E=4.9e-13 PF01895: PhoU" amino acids 346 to 424 (79 residues), 42.8 bits, see alignment E=5.8e-15 amino acids 453 to 532 (80 residues), 25 bits, see alignment E=2e-09

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 54% identity to bra:BRADO3915)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>MPMX19_01642 hypothetical protein (Azospirillum sp. SherDot2)
MQATRVLLELAGNVVLLLWGLHMVQSGLTRALGGDLRRILGAGLRNRWTAFLSGMGITML
LQSSTATGLMATGFTATGLVSLMPALAVMLGANVGSTLIVQILAFDVAHVAPVLLLGGFI
AFRRGARTRSRDLGRVAIGLGLMLLSLHLLLATIAPAENAPMLRRMLAMLTADPVVAVML
AALLSWAAHSSVAAILLIASLAGGGVIGPEAAIAMVAGANLGSAVNPVIEGPGGDGRNPA
ARRLPVGNLINRLVGCLIVVPLLGPITAGLQAVSPDATRLAANFHLTFNLAMAGLFIGPL
PWFARALTRMFPERVAVADPAMPLYLDRSALRIPHLAIANASREALRMADTVDGMLRGAL
DVIQTDDRKRVQEIRRMDDVLDRLHEAIKGYLTQINVEDLDESDASRMSDVLTFTINLEH
VGDIVDCNLMETASKKIRRKLRFSTEGAGEIAGMLERLSETQRLAAAVFVSRDVRSARAL
IHEKEVIRDLETSATEAHFARLRAGRKESVETSALHLDILRDLRRINAHLVAAAYPVLDQ
SGELLPSRLKRGAARA