Protein Info for MPMX19_01629 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 PF08447: PAS_3" amino acids 44 to 131 (88 residues), 59 bits, see alignment E=7.1e-20 amino acids 178 to 266 (89 residues), 61.9 bits, see alignment E=8.4e-21 TIGR00229: PAS domain S-box protein" amino acids 179 to 281 (103 residues), 23.6 bits, see alignment E=2.3e-09 PF00015: MCPsignal" amino acids 337 to 498 (162 residues), 107.2 bits, see alignment E=1.3e-34

Best Hits

KEGG orthology group: None (inferred from 90% identity to azl:AZL_019830)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>MPMX19_01629 hypothetical protein (Azospirillum sp. SherDot2)
MLSFRKPQDNQAAEELALLGRHAGVGLWDAVIHNGDPMHAQSRWHWSPEFRRLVGFGHDD
TAGFPDKVGSWADRLHPDDAKPTFDSFMACLNDRSGRTGYDVNYRLKVKDGSYRWFRAIG
GVARDSSGLALRACGSLIDIDAERNELERAKLLDRHAGVGLWDAVFYNADPMHAQSRWHW
SPEFRRLAGFDRDDKIGFPDGVNSWADRLHPDDAKRTFDGFMACLNDRSGRTGYDVDYRL
KLKDGTYRWFRAIGGVARDGNGLALRACGSLIDIHGQKMAELRQAELDGERRSSIANLAE
SLDREVGTAADRATANAQTVAAATEELSASISDISNRANEASGASLKASEEATRTNAAVE
ALVTSAERIGAITKLINSIASQTNLLALNATIEAARAGEAGRGFAVVANEVKSLAQQSGS
AADDIAAQIASVQQEALHAVDAIRRIGSIVTDVQQISTTIAAAVSQQESATKEIAHSVTR
VVRDIEVVSQNIASTSERLRA