Protein Info for MPMX19_01625 in Azospirillum sp. SherDot2

Annotation: Oxalate:formate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details TIGR04259: oxalate/formate antiporter" amino acids 21 to 425 (405 residues), 626.7 bits, see alignment E=8.1e-193 PF07690: MFS_1" amino acids 29 to 282 (254 residues), 97.7 bits, see alignment E=3.5e-32 amino acids 246 to 418 (173 residues), 43.9 bits, see alignment E=7.8e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to azl:AZL_019790)

Predicted SEED Role

"Oxalate/formate antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>MPMX19_01625 Oxalate:formate antiporter (Azospirillum sp. SherDot2)
MAHMNSQPAAESAAPVTDAVRWTQIVVGIVCMVAAANIQYAWTLFVPEIQATHGWTRASI
QTAFTIFVVVQTWLTPIEGYFIDKYGPKVIVAAGGFFTGLSWIVDSYAGTLTMLYVGSAI
GGIGVGCVYATCVNNALKWFPEKRGLAVGLTAGGYGAGSALTILPISSMIHSSGYQSAFF
WFGLVQGAIIICAALFLRMPQKEQVKASTKVAQTRRDYTLGEAIRTPVFWVMWAMFIGTV
TGGLMAVAQLGVIAHDLGVKEAPVSVLGLTMAALPFALMLDRVMNGISRPLFGFISDHIG
REATMFVAFTLEGVGIIMLSRFGHDPMMFLILSGMVFLAWGEVYSLFSATSADTFGTKHA
GKIYGVLYCAKGVAALLVPLGNLLMEATGTWATVLYVTATMDLTAAACALLVLKPMLARH
HARNEELARRAEHGDATRAVPVGAAAGTANG