Protein Info for MPMX19_01608 in Azospirillum sp. SherDot2

Annotation: Release factor glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 63 to 296 (234 residues), 165.5 bits, E=5.2e-52
• PF05175: MTS
  • amino acids 154 to 217 (64 residues), 33.9 bits, E=6.4e-12
• PF13489: Methyltransf_23
  • amino acids 159 to 266 (108 residues), 29.7 bits, E=1.3e-10
• PF13649: Methyltransf_25
  • amino acids 161 to 254 (94 residues), 37.3 bits, E=9.4e-13
• PF08241: Methyltransf_11
  • amino acids 161 to 257 (97 residues), 25.4 bits, E=4.5e-09

Best Hits

Swiss-Prot: 44% identical to PRMA_CHESB: Ribosomal protein L11 methyltransferase (prmA) from Chelativorans sp. (strain BNC1)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 99% identity to azl:AZL_019650)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (296 amino acids)

>MPMX19_01608 Release factor glutamine methyltransferase (Azospirillum sp. SherDot2)
MSQTPLWRIALVVPEAHAPAFAEAVGDHADAVSTFELEEGGNWLVEATLYGAPDEARLQS
RVAVLAKALGIEEPRLAVENLPPIDWVSHSYQGFPPIRAGRFFVHGSHHEGIVPAGSIPL
LVDAATAFGTGEHGSTNGCLQALDRLSRHLKLPRGGKRGALDMGCGSGILALAVAKRWRV
PVTAVDIDPEAVRVTRINAALNGQKGMIRAQGGDGYHTRIVGRHKPYTLITANILARPLS
RMAPQLRRHLKKGGYAVLAGLLNRQERHVIQAHRNQGLRLVARIPVGEWTTLVVKR