Protein Info for MPMX19_01585 in Azospirillum sp. SherDot2

Annotation: Zinc uptake regulation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF01475: FUR" amino acids 24 to 144 (121 residues), 38.4 bits, see alignment E=6.2e-14

Best Hits

KEGG orthology group: K09823, Fur family transcriptional regulator, zinc uptake regulator (inferred from 96% identity to azl:AZL_019410)

Predicted SEED Role

"Zinc uptake regulation protein ZUR" in subsystem Oxidative stress or Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>MPMX19_01585 Zinc uptake regulation protein (Azospirillum sp. SherDot2)
MSALHDHTHCIADALTRADALCAERGARLTALRRRVLELVWSSHRPRGAYAILEDLSQQE
GKAAAPLTVYRALEFLVEQGLVHRIESLNAYVGCAAPGDVHSGQFLVCEACGDAAEIDDP
DVGAAIDAAAAGRGFRVQRPTVEVRGLCKSCQENPR