Protein Info for MPMX19_01486 in Azospirillum sp. SherDot2

Annotation: Flagellar L-ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02107: FlgH
  • amino acids 67 to 253 (187 residues), 194.6 bits, E=5.3e-62

Best Hits

Swiss-Prot: 52% identical to FLGH_OLICO: Flagellar L-ring protein (flgH) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K02393, flagellar L-ring protein precursor FlgH (inferred from 92% identity to azl:AZL_018360)

Predicted SEED Role

"Flagellar L-ring protein FlgH" in subsystem Flagellar motility or Flagellum

Protein Sequence (254 amino acids)

>MPMX19_01486 Flagellar L-ring protein (Azospirillum sp. SherDot2)
MSATMTARLIRFAMIATAATSLTACGAASRIADIGKAPEMSGIQDPQAKTGYQPVSLPMP
TPLPTERNPNSLWRTGAKAFFKDQRAAKVGDILTINISIADQAKLSNESKRSRANTEKAG
MPNLFGLEGATLNRVLPAGASAASLVDLSSDTSNDGKGSVDRNEKIELKVAALVTQTLPN
GNLVIQGHQEVRVNYELRDLQIHGVIRPEDITAQNTISYEKIAEARISYGGRGQITDVQQ
PRYGQQLYDIIMPF