Protein Info for MPMX19_01478 in Azospirillum sp. SherDot2

Annotation: DNA topoisomerase 4 subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 14 to 741 (728 residues), 860.4 bits, see alignment E=5e-263 PF00521: DNA_topoisoIV" amino acids 34 to 465 (432 residues), 483.6 bits, see alignment E=5.8e-149 PF03989: DNA_gyraseA_C" amino acids 554 to 600 (47 residues), 7.7 bits, see alignment 0.00027 amino acids 607 to 640 (34 residues), 22.8 bits, see alignment (E = 5e-09) amino acids 652 to 687 (36 residues), 22 bits, see alignment (E = 9.1e-09)

Best Hits

Swiss-Prot: 61% identical to PARC_RHIME: DNA topoisomerase 4 subunit A (parC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 97% identity to azl:AZL_018280)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (741 amino acids)

>MPMX19_01478 DNA topoisomerase 4 subunit A (Azospirillum sp. SherDot2)
MKPQNPASEILEKPLADALGERYLSYALSTIMSRSLPDVRDGLKPVHRRLLFAMSQLRLE
PTTPPKKSARVVGDVIGKFHPHGDTSVYDALVRLAQDFSVRYPLVDGQGNFGNIDGDNAA
AMRYTEARLTEVAKALLEGIDEDAVDFRPTYDGDGDEPAVLPANFPNLLANGSSGIAVGM
ATNIPPHNVGEICDALRHLIKHRDASIETLVGFMPGPDFPTGGLLVESRQNVIEAYRTGR
GAFRLRARWEVEKLGQGTWQIVVTEMPYQVQKARLVEKIAELLLAKKLILLDDVRDESAE
DVRLVLVPKNRNVDPEVLMASLFQATDLEIRFSMNMNVLGADHVPRVMNLREVLQAFLDH
RHEVLVRRSTYRLKQIDHRLEVLGGYLAAYLNLDEVIRIIREEDEPKQQLIRAFTLTDVQ
ADAILNMRLRNLRKLEEMEIRREHEALTTEKNGLLELLGDETLRWKRIAEGVAEIKKKFG
AGALGKRRTDVADAPTVIEVPLDALVEREPVTVICSAKGWIRTVRGHLTDAEAEDVKYKD
GDERGFIERCETTDKLLVFASNGKFFTIGVDKLPRGRGFGEPVRLMIDLGNDVDIVDLFR
HQPGRTLLVVSEDGRGFRVEEAEVLAQTRAGKQVLNLEDGKSARICQPVSGDTLAIIGNN
RKMLVFPLEQVPVMTRGKGVQLQKYKDASVADVKTFTLAQGLSWKNGERNFTVTDLTGWM
GDRAGQGKMPPNGFPKNNRFM