Protein Info for MPMX19_01424 in Azospirillum sp. SherDot2

Annotation: Fumarate hydratase class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00979: fumarate hydratase, class II
  • amino acids 4 to 461 (458 residues), 787.8 bits, E=1.5e-241
• PF00206: Lyase_1
  • amino acids 12 to 342 (331 residues), 396 bits, E=1.4e-122
• PF10415: FumaraseC_C
  • amino acids 408 to 460 (53 residues), 95.3 bits, 2.3e-31

Best Hits

Swiss-Prot: 73% identical to FUMH_RHIOR: Fumarate hydratase, mitochondrial (FUMR) from Rhizopus oryzae

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 95% identity to azl:AZL_017510)

MetaCyc: 70% identical to fumarate hydratase monomer (Homo sapiens)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• mixed acid fermentation (14/16 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• reductive TCA cycle II (7/12 steps found)
• methylaspartate cycle (12/19 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Protein Sequence (463 amino acids)

>MPMX19_01424 Fumarate hydratase class II (Azospirillum sp. SherDot2)
MSGVRTETDSFGPIDVPADRYWGAQTQRSLQNFRIGGERMPVPLVRALGIQKRAAAAANM
TLGVLDPKLGAAIMEAADEVIDGRLADHFPLVVWQTGSGTQTNMNANEVIANRAIERLGG
TMGSKTPIHPNDHVNMGQSSNDSFPTAMHIAAADEIMHSLIPALEHLRTALDAKADAFQD
IVKIGRTHLQDATPLTLGQEFSGYAAQVSYGIGRVKGALPQLYRLAQGGTAVGTGLNAKP
GFAEAFAEEVAAFTGLPFVTAENKFEALATHDSLVDVHGHLNTLAVSLMKIANDIRLLGS
GPRSGIGELSLPENEPGSSIMPGKVNPTQSEAMTMVCAQVMGNHTTVTVAGATGHFELNV
FKPVIVFNVLQSIRLLADAANSFTDNCVVGIEANRERIAKLVSDSLMLVTALNPHIGYDN
AAKIAKKAHKEGTSLKEAGRELGLLTDEQFDQWVRPERMVGPG