Protein Info for MPMX19_01419 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 6 to 309 (304 residues), 76.7 bits, see alignment E=8.9e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>MPMX19_01419 hypothetical protein (Azospirillum sp. SherDot2)
MRFPVLDGWRGLCALFVALFHFNASGHFYLVPFVRGSYLFVDFFFVLSGFVITHAYIHRL
NSTADGRSFLVRRLGRVWPLHAATLIAFIPLEIVKALAVSGETAAFTARFAPSSILSNLF
LVHSLGIEDGLTWNIPSWSISAEFLAYVTFAALCLLARRTWLVTASAVALSAAGAFVVMG
WSDQYIDTSFDFGYFRCLYGFFTGHVTYRLFQAARGAGLPRLPMRLPIASLLEGLSLATV
VVFVATARGNALSYASPLLFGLIVWVFAFEGGVFSRRLAMRPFQWLGARSYSVYMVHALV
IALYEKAAVAMQRLSGQPMFVEQAADGTEDRLISFGATWMMDLLALAYLGTVVAVASLTY
RFVEIPGQSSFNALLLKRRKLAVRPTAMEVT