Protein Info for MPMX19_01408 in Azospirillum sp. SherDot2

Annotation: Flavin prenyltransferase UbiX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 12 to 24 (13 residues), see Phobius details PF02441: Flavoprotein" amino acids 10 to 179 (170 residues), 147.2 bits, see alignment E=1.7e-47 TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases" amino acids 10 to 190 (181 residues), 242.7 bits, see alignment E=1.1e-76

Best Hits

Swiss-Prot: 62% identical to UBIX_ECOLI: Flavin prenyltransferase UbiX (ubiX) from Escherichia coli (strain K12)

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 95% identity to azl:AZL_017380)

MetaCyc: 62% identical to flavin prenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>MPMX19_01408 Flavin prenyltransferase UbiX (Azospirillum sp. SherDot2)
MTDPTTPPPRLVVGISGASGVIYGIRMLQTLRRLGVESHLVVSRSAEVTLAHETAMKVAE
LRALADVSYAAADIGAAVSSGSFRTLGMVVAPCSVRTMSEIASGVTSTLLTRAADVALKE
RRRLVLMVRETPLHLGHLRTMTALAEMGAVIAPPVPAFYAKPQGIDDLVDHSVGRVLDLF
GLDAGNLRRWGERQGDT