Protein Info for MPMX19_01388 in Azospirillum sp. SherDot2

Annotation: Outer membrane protein assembly factor BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF13360: PQQ_2" amino acids 106 to 159 (54 residues), 25.5 bits, see alignment 1.4e-09 amino acids 138 to 374 (237 residues), 220.9 bits, see alignment E=2.9e-69 amino acids 390 to 454 (65 residues), 24 bits, see alignment E=4.4e-09 PF13570: PQQ_3" amino acids 149 to 193 (45 residues), 22.1 bits, see alignment 2.5e-08 amino acids 195 to 233 (39 residues), 32.8 bits, see alignment 1e-11 PF01011: PQQ" amino acids 176 to 211 (36 residues), 20.9 bits, see alignment 3.5e-08

Best Hits

KEGG orthology group: None (inferred from 90% identity to azl:AZL_017100)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>MPMX19_01388 Outer membrane protein assembly factor BamB (Azospirillum sp. SherDot2)
MKTKTEKTAMVGSIRRAALLSASLLTVLLAGCDTIDSWMGKTPDPPLPGKRVAVLQRERK
VEPDAQLAATAVTVPPPVANAAWAQPGGTPDHVLGNLALSASPSDAWRADIGAGSSSSRA
LLGTPVIADGRIFAMDADSHVTALNERSGQSLWRFDTRPENERGGATGGGVAYADGRVYA
ATGFAEVLAFDAGSGKVLWRKRIAGPVRGAPTVAGGRVLVITLDNQTIALSTDDGAVQWS
QQGILETAGLLGAASPAATGTLVVSPYSSGELFGLRPENGRVAWQDSLANIRRSGALSNL
ADIRGLPVVDRGAVYAIGHSGRMVAIDERIGARIWETEIGGVQTPWLAGDYLFTVTNDQE
VVAVARQNGKVRWVAPLARFTDPEDRSGPIVWSGPVMAGSRLWVAGSNGQLLGLSPSDGK
VEVTRSLPTGSYLSPVVANNTLYVLCDNGTLVAFR