Protein Info for MPMX19_01378 in Azospirillum sp. SherDot2

Annotation: GTP-binding protein TypA/BipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 TIGR00231: small GTP-binding protein domain" amino acids 1 to 148 (148 residues), 81.7 bits, see alignment E=5.3e-27 PF00009: GTP_EFTU" amino acids 2 to 194 (193 residues), 186.2 bits, see alignment E=1.4e-58 TIGR01394: GTP-binding protein TypA/BipA" amino acids 3 to 600 (598 residues), 938.7 bits, see alignment E=1.1e-286 PF22042: EF-G_D2" amino acids 204 to 289 (86 residues), 39.4 bits, see alignment E=1.6e-13 PF03144: GTP_EFTU_D2" amino acids 218 to 289 (72 residues), 49.4 bits, see alignment E=1.5e-16 PF00679: EFG_C" amino acids 399 to 483 (85 residues), 75.3 bits, see alignment E=9.7e-25 PF21018: BipA_C" amino acids 486 to 594 (109 residues), 158 bits, see alignment E=2e-50

Best Hits

Swiss-Prot: 56% identical to TYPA_ECOLI: GTP-binding protein TypA/BipA (typA) from Escherichia coli (strain K12)

KEGG orthology group: K06207, GTP-binding protein (inferred from 99% identity to azl:AZL_012510)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>MPMX19_01378 GTP-binding protein TypA/BipA (Azospirillum sp. SherDot2)
MNLRNVAIIAHVDHGKTTLVDQLLKQAGSFRENQQVAERAMDSNDLERERGITILAKCTS
VLWNDLRINIVDTPGHADFGGEVERILSMVDGVVLLCDAAEGPLPQTKFVLGKALKLGLR
PIVVINKVDRPDGRPHEVHDEVFDLFASLDASNEQLDFPTLFASGRNGWATTDLENGARE
TLTPLFELIRDHVPAPKVEEDLPFSMLATTLEANPYLGRILTGRILTGSVKVNMAVKSMS
RDGKLIENARISKVLAFRGLERVPVDEAHAGDIIALAGLTNTTVADTICAPEVAEAIHAQ
PIDPPTLAMTFSVNDSPLAGREGDKVTSRMIRDRLFREAEGNVALRISDTEGGDAFEVAG
RGELQLGILIETMRREGYELAISRPRVLFKTDPLNGQRLEPIEEVVVDVDEEFSGTVVQK
MSERKADLIEMRPSGGNKTRIVFHAPSRGLIGYQGEFLTDTRGTGIMNRLFHGYAPFKGA
IAARRTGVLISNSDGTAVAYALWNLEDRGPMLIDPGVLVYQGMIIGEHTRGNDLEVNVIK
GKQLTNIRTTSKDEAVRLTPPIQMTLEKALSYISDDELVEVTPKSIRLRKRYLDPNERKR
HSRAAEAS