Protein Info for MPMX19_01366 in Azospirillum sp. SherDot2

Annotation: Cadmium, cobalt and zinc/H(+)-K(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 46 to 318 (273 residues), 264 bits, see alignment E=8e-83 PF01545: Cation_efflux" amino acids 50 to 236 (187 residues), 146.6 bits, see alignment E=4.3e-47

Best Hits

Swiss-Prot: 35% identical to ZITB_SALTY: Zinc transporter ZitB (zitB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 84% identity to azl:AZL_012620)

MetaCyc: 37% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>MPMX19_01366 Cadmium, cobalt and zinc/H(+)-K(+) antiporter (Azospirillum sp. SherDot2)
MPHGHSHGGSTHLDRDHAGHDHSDHGHSEHGHAGHQHHHGPVRYDRSFALGALLNIGFVV
VEAVYGLIANSTALIADAGHNLSDVMGLLLAWGAVWLGRRIPQGRYTYGFGNASILASLL
NAMILLIAVGAILLEAVNRLADPEPVGETTVMVVAAVGIVINGWTAWLFMGGQKHDINLR
GAYLHMAADAAVSLGVVVAALVIRFTGWLWLDPVTSILIALVIVAGTWGLLRDSVRLAMG
AVPDGVDRTGVERYLAGLPGVTAVHDLHIWPISTTETALTAHLVRPGMDQDDALLLEIST
VLKERFGIGHATIQVEHDGSCCRLAPADVV