Protein Info for MPMX19_01302 in Azospirillum sp. SherDot2

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 29 to 48 (20 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 1 to 165 (165 residues), 104.3 bits, see alignment E=4.1e-34

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 96% identity to azl:AZL_013120)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>MPMX19_01302 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Azospirillum sp. SherDot2)
MSVPNIITFLRIVAVPAAMYMILTGRMEWAFALFVAAGLSDALDGAIARMFRARTVLGGY
LDPLADKALIVGVYIALAWVGTIPLWLAMMVVFRDIMIIGGVILLFTLKETLAMQPLYIS
KVNTVVQIALAAAVLAPPALGLPDIHLYGWELVEVLVYVCTVTTVLSGVLYARRGALLFN
RLGGVP