Protein Info for MPMX19_01301 in Azospirillum sp. SherDot2

Annotation: AI-2 transport protein TqsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 9 to 41 (33 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 231 to 262 (32 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 301 to 337 (37 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 334 (321 residues), 212.3 bits, see alignment E=5.3e-67

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_013130)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>MPMX19_01301 AI-2 transport protein TqsA (Azospirillum sp. SherDot2)
MTPAKQLRFWLIGLGLFVLALWLLADMLLPFVVGLAIAYLLDPAVDRLEAAGLPRWLGTT
LVLLGFVLVMVLMALLLLPLVQGQVSHLLEVLPNYATLAKERLIPALNRFIHRLPADDVE
RLRAAAGNYAGEVAGLVGRVVTRILSGGLALFDIVTLMFITPVVAFYMMRDWDLMVGKVD
SWLPRQHAETVREQAREVNVTLSGFVRGQATVCVVLGVFYALALSAAGLDFGLVIGLMAG
LLSFIPYVGTLFGFVASTGLALLQFDEFWRVAIVIGIFLFGQAVEGNVLTPKLVGDKVGL
HAVWVMFALLAGGSLFGFVGVLLAVPVAAVIGVLTRFALRQYLSSPYYRGTDAER