Protein Info for MPMX19_01268 in Azospirillum sp. SherDot2

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 788 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details PF03707: MHYT" amino acids 66 to 116 (51 residues), 72.8 bits, see alignment 7.2e-24 amino acids 130 to 187 (58 residues), 73.1 bits, see alignment 5.7e-24 TIGR00229: PAS domain S-box protein" amino acids 277 to 403 (127 residues), 120.7 bits, see alignment E=2.1e-39 PF13188: PAS_8" amino acids 281 to 333 (53 residues), 28.2 bits, see alignment 5.4e-10 PF00989: PAS" amino acids 282 to 394 (113 residues), 63.5 bits, see alignment E=7.2e-21 PF08448: PAS_4" amino acids 288 to 399 (112 residues), 26.5 bits, see alignment E=2.6e-09 PF13426: PAS_9" amino acids 292 to 396 (105 residues), 47.4 bits, see alignment E=8.1e-16 PF00512: HisKA" amino acids 431 to 496 (66 residues), 43.1 bits, see alignment E=1.4e-14 PF02518: HATPase_c" amino acids 541 to 649 (109 residues), 76 bits, see alignment E=1.3e-24 PF00072: Response_reg" amino acids 672 to 784 (113 residues), 38.8 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: None (inferred from 88% identity to azl:AZL_013440)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (788 amino acids)

>MPMX19_01268 Sensor histidine kinase RcsC (Azospirillum sp. SherDot2)
MPGHYDPLLVALSYVIAVFGGYVALDLAHHSRSGTAGQSLVSDLRKATGSGPGDKRRLAG
AALALGAGIWSMHFIGMLAYRSDMPIGYDAGLTALSFVLAVGVSGAGLFAVARNRHNNYF
KLPIAGTLTGLGIVSMHYVGMAGMRMDMDLSYDVVLVAVSVIVAIAASTAALWLAFRTSR
PLQRASGAVLLGLGVVTMHYTGMAAAGMEPITELSTAIGGADANPTVLSHAASHSGQGIA
LSSSLLAIMTGMGTLLLLSLAMLSSMLDRRQQAERSAEQEARYRAIVDTAVDPIVLIDDR
GIVESFNYAAEKTFGYRAEEVIGRNINMLMPEPYRSAHDGYLDRYHRTGERRIVGIGREV
DGLRKDGSTFPLDLSVGEWHVGKRRMYTGIMRDITARRASEEAILRARDEAEAAKVEALQ
ARDDAQRADRAKTKFLAAASHDLRQPLQSLFFFAHALSDKLEDHPAAPLLASMTDSLNGL
RVMLDSLLDVSRLDAGVVKPSVTDFALGPLLERLTEEYRIRAAESGLTLRHVPTSAWTRS
DPALLERILRNLIENAIRYTERGDILIGCRHRAGALRLVVLDQGIGIPADKFQDIFQEFT
QLANPERDRRKGLGLGLAIVRRLAGLLDHGVTVQSVPGRGSGFFLDVPTAVPRPIPKPVR
VPAELPDAKGLIVVVDDDTIILLSMRAMLEEWGYEVVAAVSADEAIASLLNLGRQPAMIV
ADYRLREGRTGVEAIRDIYGVCGVRVPAVVLTGDTDPARIAEVQRSGHRLIHKPVSAPML
REILTTAA