Protein Info for MPMX19_01264 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 TIGR00229: PAS domain S-box protein" amino acids 201 to 321 (121 residues), 54.4 bits, see alignment E=1.4e-18 PF13188: PAS_8" amino acids 203 to 260 (58 residues), 32.6 bits, see alignment 1.4e-11 PF00989: PAS" amino acids 203 to 293 (91 residues), 42.6 bits, see alignment E=1.4e-14 PF13426: PAS_9" amino acids 220 to 312 (93 residues), 39.5 bits, see alignment E=1.4e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 322 to 486 (165 residues), 171 bits, see alignment E=1.8e-54 PF00990: GGDEF" amino acids 325 to 481 (157 residues), 148.5 bits, see alignment E=3.8e-47

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>MPMX19_01264 hypothetical protein (Azospirillum sp. SherDot2)
MPVPGCMAMISGRDAHDGRDAALSILDRLPVGVCVVAASGIIHHANPALHTLLACEPGGL
PGRSLCEFGLDTCDDGGPAADPARAHRALRNDGTVCRVTVEEAPWTSLPSGAKAEGGAES
LRLVTVTDVDAVYRQAMLADEAASQAGSPATGTLLDYGGNVRYEAPVLVAKGATRFPAMG
NFRDESGIAGVSRELDALHPNEERLEAILEQSPIGVSVSRRDDGCIIFVNTRFAELIGLP
REKLIGSRARDYYLDSHQRLRVLERLRGGGGVTNMEVQFRRADGSPFWTLFTVNQAVIQG
TAVNLAWIYDYTERRSMEEALRDMASRDPLTGIFNRRSFMDMARAQLARAHRFHEPLSVF
VLDVDHFKRINDSFGHATGDDALRMVAAGCQAILREYDILGRLGGEEFVVVLPGATADES
RVVAERVRRHLARMPIEAPDGTFRLTVSIGIAGLEGATDTLERAIHRADLALYRAKHLGR
NLVAVFEPGM