Protein Info for MPMX19_01234 in Azospirillum sp. SherDot2

Annotation: Multidrug resistance protein MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 63 to 108 (46 residues), 27.4 bits, see alignment 3.5e-10 PF16576: HlyD_D23" amino acids 185 to 353 (169 residues), 69.7 bits, see alignment E=3.4e-23 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 205 to 374 (170 residues), 98.7 bits, see alignment E=1.7e-32 PF13437: HlyD_3" amino acids 243 to 350 (108 residues), 50 bits, see alignment E=6.9e-17

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 91% identity to azl:AZL_013760)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>MPMX19_01234 Multidrug resistance protein MdtA (Azospirillum sp. SherDot2)
MAKGAGRRAAIFLGLALSAAAGLSAYVVLARAEPGPAYRLARVEQGPLVSAITATGTMSA
LVTVEVSSQLSGQIAELYADFNSRVTSGQILARLNGDQLAARLAQAGADVDSAKAALIQQ
QALLDKARADLANANASIANADAQIVRADLAQRDAERDLWRRRDLQGRGVVAAADLEKAE
TAAHSAQAQLIAARAQKRQAEAAEASAEASLAVAAAQVEVARAQVAQREAALQLVRVDLN
RSVIRSPIDGVVVNRAVSTGQTVAASLSAPTLFTIAQDLRQMEVLANIDEADIGRVREGM
AVRFTVNAFPGDSFTGRVAQVRLAPKEDQTVVTYIVVITVENPELRLLPGMTANLRITVD
ERPSAVKLPNAALRFRPPGVESSADAPAPTTGGLNGGRGAAALEAAAKRVTDGLKLDEIK
RRDIAALVAEARERFTALDAEGGDPERRRVEANAIRTATLERMAGLLDPAQRDRFESLID
PGRAAEATRTVWVPSPGNGSPVGVPVRLGIGDGSFTELVSGDLRAGQEVITGILAADRDT
RRGPRLGF