Protein Info for MPMX19_01218 in Azospirillum sp. SherDot2

Annotation: SsrA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR00086: SsrA-binding protein" amino acids 12 to 153 (142 residues), 172.4 bits, see alignment E=2.9e-55 PF01668: SmpB" amino acids 12 to 154 (143 residues), 181.4 bits, see alignment E=4.5e-58

Best Hits

Swiss-Prot: 57% identical to SSRP_AZOC5: SsrA-binding protein (smpB) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03664, SsrA-binding protein (inferred from 97% identity to azl:AZL_013960)

Predicted SEED Role

"tmRNA-binding protein SmpB" in subsystem Heat shock dnaK gene cluster extended or Staphylococcal pathogenicity islands SaPI or Trans-translation by stalled ribosomes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>MPMX19_01218 SsrA-binding protein (Azospirillum sp. SherDot2)
MATREEAKKYAAQNRRARFDFFIDDVLEAGIMLTGSEVKSLRGGRASVNEAYAGLKSGEL
YLFNAYIPEYLQAGRIDQHEPKRPRKLLVRRRELDKLAAGIKQKGVTLVPMSVYFNDRGY
AKVEIGLATGKKKHDKRQSEKDRSWQRDKARLMRDKG