Protein Info for MPMX19_01204 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 296 (248 residues), 115.9 bits, see alignment E=9.3e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 86% identity to azl:AZL_014100)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>MPMX19_01204 hypothetical protein (Azospirillum sp. SherDot2)
MSLHSQSSGRASGEAVKASSAGSTLARVGALAVLVALLAVPFLLYPVFLMKVLCFALFAC
AFNLLIGFGGLLSFGHAAFFGSAAYVTAHTVKVWGLSPELGILLGTAASAFLGILFGSIA
IRRQGIYFAMITLALSQMVFFLALQLPFTHGEDGIQAVPRGVLFGVFDLNNPLAMYYTVL
GVFLIGFAIIWRTVHSPFGQVLKAIRENEPRAISLGYRTERYKLMAFVLSATLAGLAGGT
KAIVFQLATLTDVTWQMSGEVVLMTLLGGMGTLTGPVIGAALVVTLENYLAATSLPVPVV
IGCIFVACVLVFRRGIAGEIQARFEKQSRSG