Protein Info for MPMX19_01161 in Azospirillum sp. SherDot2

Annotation: Superoxide dismutase [Fe]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 3 to 86 (84 residues), 110 bits, E=6.6e-36
• PF02777: Sod_Fe_C
  • amino acids 96 to 193 (98 residues), 120.9 bits, E=2.2e-39

Best Hits

Swiss-Prot: 63% identical to SODF_SYNE7: Superoxide dismutase [Fe] (sodB) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 98% identity to azl:AZL_014560)

MetaCyc: 54% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (197 amino acids)

>MPMX19_01161 Superoxide dismutase [Fe] (Azospirillum sp. SherDot2)
MAFELPPLPYAYDALAPYISSETLHLHHDKHHQTYVTNLNNLTKDTPLADASLEEVIKAS
AGDSSKVGIFNNAAQVWNHTFFWQCLKKDGGKMPAALEQRIVADFGSVEKFKEELTQAAL
TQFGSGWAWLYLDGGKLKVGKTGNADTPLAHGQKPLFTIDVWEHAYYVDFQNRRADFVKA
VIDNLANWDFAAEQLAA