Protein Info for MPMX19_01112 in Azospirillum sp. SherDot2

Annotation: DNA-binding transcriptional regulator NtrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 96.5 bits, see alignment E=3.4e-31 TIGR01818: nitrogen regulation protein NR(I)" amino acids 6 to 472 (467 residues), 749.5 bits, see alignment E=7e-230 PF00158: Sigma54_activat" amino acids 141 to 307 (167 residues), 238.4 bits, see alignment E=1.1e-74 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 84.2 bits, see alignment E=3.1e-27 PF07724: AAA_2" amino acids 164 to 282 (119 residues), 30.4 bits, see alignment E=1.2e-10 PF07728: AAA_5" amino acids 165 to 283 (119 residues), 31.8 bits, see alignment E=3.9e-11 PF02954: HTH_8" amino acids 432 to 470 (39 residues), 44.6 bits, see alignment 2.9e-15

Best Hits

Swiss-Prot: 93% identical to NTRC_AZOBR: DNA-binding transcriptional regulator NtrC (ntrC) from Azospirillum brasilense

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 99% identity to azl:AZL_015070)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>MPMX19_01112 DNA-binding transcriptional regulator NtrC (Azospirillum sp. SherDot2)
MSAATILIADDDRAIRTVLTQALARLGHEVRTTGNAATLWRWVADGQGDLVITDVVMPDE
NGLDLIPRIKKLRPEMRVIVMSAQNTLITAVKAAERGAFEYLPKPFDLKELVSVVERALN
TNTPPAAMPGGDMESEEQLPLIGRSPAMQEIYRVLARLMGTDLTVMITGESGTGKELVAR
ALHDYGKRRNGAFVAINMAAIPRELIESELFGHEKGAFTGATNRSTGRFEQAQGGTLFLD
EIGDMPLDAQTRLLRVLQEGEYTTVGGRTAIKTDVRIIAATHRDLRTLIRQGLFREDLFY
RLCVVPIRLPPLRERTEDIPLLVRHFLNLGISQGLPAKSIDQAAMDRLKRYRWPGNVREL
ENLVRRLAALYSQEVIGLDVVEAELADATPAAQPVEEPQSEGLSSAVERHLKDYFAAHKD
GMPSNGLYDRVLREIERPLISLSLSATRGNQIKAAQLLGLNRNTLRKKIRDLDIQVMRGI
K