Protein Info for MPMX19_01111 in Azospirillum sp. SherDot2

Annotation: Sensory histidine kinase/phosphatase NtrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF00989: PAS" amino acids 30 to 131 (102 residues), 55.1 bits, see alignment E=1.8e-18 PF13188: PAS_8" amino acids 30 to 81 (52 residues), 24.1 bits, see alignment 6.3e-09 PF08448: PAS_4" amino acids 31 to 113 (83 residues), 37.2 bits, see alignment E=7.7e-13 PF00512: HisKA" amino acids 152 to 209 (58 residues), 52.3 bits, see alignment E=1.2e-17 PF02518: HATPase_c" amino acids 255 to 373 (119 residues), 77.7 bits, see alignment E=2.4e-25

Best Hits

Swiss-Prot: 81% identical to NTRB_AZOBR: Sensory histidine kinase/phosphatase NtrB from Azospirillum brasilense

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 96% identity to azl:AZL_015080)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>MPMX19_01111 Sensory histidine kinase/phosphatase NtrB (Azospirillum sp. SherDot2)
MDPVPMTAPGQRGRNRSGAARAPRLDSLVVLNSLPDPVLVVDGNGDIRFVNLEGQEFFDL
SANAMEGMPLPELLPPDSPVMSLIEQVRRGSRRVSQDGVIIDTPRIGPHHVTVQVATMGD
PPDHVVLTIHERSLARKIDHSLTHRHAARSVTAMAAMLAHEVKNPLSGIRGAAQLLEENA
SDQDRVLTRLICDEADRIVALVNRMEVFSDERPLERAAVNIHTVLEHVRKVAQSGFARKI
RFVERYDPSLPPVYGNRDQLVQVFLNLVKNAAEAAPESGGEITLTTSYQHGVRMALPGGD
VRRHLPLLVTVQDNGDGIPEDLQSNLFDPFVTSKVNGTGLGLALVAKLIGDHGGTIEFDS
QPRRTVFKVSLPMYDDSKYDQPKLSGDSKISDAGLQSKGGRGTR