Protein Info for MPMX19_01101 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 TIGR01803: chorismate mutase related enzymes" amino acids 5 to 86 (82 residues), 74.2 bits, see alignment E=3.7e-25 PF01817: CM_2" amino acids 8 to 87 (80 residues), 78.9 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 41% identical to CMLD_STRVP: 4-amino-4-deoxychorismate mutase (cmlD) from Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745)

KEGG orthology group: K04782, isochorismate pyruvate-lyase [EC: 4.1.3.-] (inferred from 99% identity to azl:AZL_015180)

MetaCyc: 41% identical to 4-amino-4-deoxychorismate mutase (Streptomyces venezuelae)
RXN-20192 [EC: 5.4.99.67]

Predicted SEED Role

"Isochorismate pyruvate-lyase (EC 4.-.-.-)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 4.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.-.-.- or 4.1.3.- or 5.4.99.67

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>MPMX19_01101 hypothetical protein (Azospirillum sp. SherDot2)
MSKSLAPLRAEIDAIDDEIVALLGKRLSVVHRVAAVKMAENLPAVLPDRVEAVKRRAAEA
GLAYGLDPDFMATLYQTIIDEACRVEEGIFAAGREDAPRS