Protein Info for MPMX19_01099 in Azospirillum sp. SherDot2

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 4 to 77 (74 residues), 68.7 bits, E=6.1e-23
• PF13533: Biotin_lipoyl_2
  • amino acids 16 to 48 (33 residues), 23.8 bits, see alignment (E = 6.2e-09)
• PF02779: Transket_pyr
  • amino acids 135 to 309 (175 residues), 148.9 bits, E=2.5e-47
• PF02780: Transketolase_C
  • amino acids 325 to 447 (123 residues), 152.2 bits, E=1.3e-48

Best Hits

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 92% identity to azl:AZL_015200)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Protein Sequence (457 amino acids)

>MPMX19_01099 1-deoxy-D-xylulose-5-phosphate synthase (Azospirillum sp. SherDot2)
MPIEVLMPALSPTMTEGKLAKWLKKEGDSVKSGDVLAEIETDKATMEVEAVDEGRVGKIL
IAEGTDNVAVNTPIAVLLEEGEDESALSKAGSAPAAPAPAPVAEAAPAPAPTVPAAPVAA
PASDEDRFMAKTVKKTVREALRDAMAEEMRRDDKVFVMGEEVAQYQGAYKVTQGLLQEFG
ERRVIDTPITEIGFAGLGVGAAFKGLKPVVEFMTFNFAMQAIDHIINSAAKTLYMSGGQM
SNSIVFRGPNGAAARVGAQHSQCYASWYAHCPGLKVVSPWSAADAKGLLKAAIRDANPVV
FLENEILYGQSFEVPEDEDFVLPIGKAKVERAGKDVTITAFSIMVGHALAAAEILAKEGI
DAEVINLRTIRPLDTETIVNSVKKTNRLVSVEEGWPFAGIGSEMCALMMEQAFDYLDAPV
ARVAGLDVPMPYAANLEKLALPQVDHIVKAAKQACYR