Protein Info for MPMX19_01094 in Azospirillum sp. SherDot2

Annotation: Molybdenum transport system permease protein ModB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 13 to 222 (210 residues), 206.7 bits, see alignment E=1.6e-65 PF00528: BPD_transp_1" amino acids 27 to 226 (200 residues), 53.6 bits, see alignment E=1.2e-18

Best Hits

Swiss-Prot: 56% identical to MODB_ECOLI: Molybdenum transport system permease protein ModB (modB) from Escherichia coli (strain K12)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 96% identity to azl:AZL_015250)

MetaCyc: 56% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>MPMX19_01094 Molybdenum transport system permease protein ModB (Azospirillum sp. SherDot2)
MEILTPMETTALLLSLRVAGVAIALGLPLAVLAAWVLGRYSFPGKTLFDGLVHLPLVLPP
VVTGYILLVTMGTKGVVGGWLYQTFGIKLIFTAEGASLAVAVTSFPLMVRAIRLSVEAID
GGLEAAARTLGAGPVDRFFTILLPLMAPGLLSGAIVAFAAAMGEFGAVITFVSNIPGKTQ
TLPLAIYAATQEPGGDAVAARLAAISFTVALLALMLSEFLANRVRRLIGQV