Protein Info for MPMX19_01079 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08274: Zn_Ribbon_YjdM
  • amino acids 6 to 32 (27 residues), 45.3 bits, 7.1e-16
• TIGR00686: putative alkylphosphonate utilization operon protein PhnA
  • amino acids 6 to 117 (112 residues), 133.9 bits, E=1.2e-43
• PF03831: YjdM
  • amino acids 48 to 117 (70 residues), 111.5 bits, E=1.4e-36

Best Hits

Swiss-Prot: 63% identical to YJDM_STRMU: Protein YjdM (yjdM) from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 95% identity to azl:AZL_015400)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• phosphonoacetate degradation (1/1 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Protein Sequence (117 amino acids)

>MPMX19_01079 hypothetical protein (Azospirillum sp. SherDot2)
MDDQINCPQCSSENAYNDGSLWNCPDCGHEWNPDTAAAAVDAEAGQGVRDANGNALTDGD
SVTVIKDLKVKGSSLVVKGGTKVKNIRLVDGADGHNIACKIDGIGAMNLKSEFVKKA