Protein Info for MPMX19_01063 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 277 (265 residues), 95.4 bits, see alignment E=1.7e-31

Best Hits

KEGG orthology group: K05832, putative ABC transport system permease protein (inferred from 97% identity to azl:AZL_015540)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>MPMX19_01063 hypothetical protein (Azospirillum sp. SherDot2)
MTEIALFGAIEIGLVYALVAIGVYLSFRILDFPDLTVDGSFPLGAAVCAVLLIAGVNPWL
ASLAAALAGAAAGLVTATLNVRFKILHLLASILTMIALFSVNLRVMGRPNVALLMQDTVL
TPFYGLGIPDHIVRPLVVGVIVAAVVLLLARFLGSEFGLAMRATGVNARMARAQGVDTDA
HVYAGIALSNALTGLAGALFAQTNGFADVTTGIGTIVVGLAAVIVGETVLPARALALALV
GCVAGSILYRLAVQLALSADAIGLQASDLNLVTAVLVAVALILPRLKAKASRSTKATR