Protein Info for MPMX19_01060 in Azospirillum sp. SherDot2

Annotation: Ferrous iron permease EfeU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 61 (26 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 113 to 139 (27 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details PF03239: FTR1" amino acids 1 to 259 (259 residues), 106.7 bits, see alignment E=7.3e-35

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 92% identity to azl:AZL_015570)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>MPMX19_01060 Ferrous iron permease EfeU (Azospirillum sp. SherDot2)
MLASLIIVFREVLEAGLIVGIVLAATQGVAGRGRWIALGIVGGIVGSCVVAAFADGISSL
FADTGQELFNATVLLIAVVMLAWHNAWMAQHGRELARDMKAVGHAVRSGEKSLAALAIVI
GVAVLREGSEVVLFLTGILASEEGGIATVAAGGLGGMALGALVSVLLYVGLVQIPTRHLF
ATTTWLLTLLAAGMAATAVNFLAQGGMLNAGGTVLWDSSGILRDNSLIGQALHVLVGYTD
RPTEAQLIAYVGVVVGILLLTRWAAGNSPSNRSRVASAAE