Protein Info for MPMX19_01052 in Azospirillum sp. SherDot2

Annotation: Glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 4 to 192 (189 residues), 171.6 bits, see alignment E=8.4e-55 PF02660: G3P_acyltransf" amino acids 10 to 183 (174 residues), 175.5 bits, see alignment E=4.8e-56

Best Hits

Swiss-Prot: 68% identical to PLSY_MAGSA: Glycerol-3-phosphate acyltransferase (plsY) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 94% identity to azl:AZL_015650)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>MPMX19_01052 Glycerol-3-phosphate acyltransferase (Azospirillum sp. SherDot2)
MLTLVLAALLGYLLGSIPFGLVLTRMAGLGDIRQIGSGNIGATNVLRTGNKPLALATLLL
DSGKGAIAALLALWWAGPEAAVLAAGGAMLGHSFPVWLGFKGGKGVATAIGVLLAVCWPV
GLLACLTWIVMAALFRISSLSALTALGLSPLTGWYFGGPLVAGLCLFIAVLVFIRHEANI
RRLLKGEEPKIGAGKKKAA