Protein Info for MPMX19_01025 in Azospirillum sp. SherDot2

Annotation: Cobyric acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 PF13500: AAA_26" amino acids 9 to 235 (227 residues), 61.6 bits, see alignment E=1.5e-20 PF01656: CbiA" amino acids 11 to 242 (232 residues), 75.5 bits, see alignment E=5.4e-25 TIGR00313: cobyric acid synthase CobQ" amino acids 11 to 483 (473 residues), 466.6 bits, see alignment E=4.9e-144 PF07685: GATase_3" amino acids 259 to 443 (185 residues), 198.5 bits, see alignment E=1.4e-62

Best Hits

Swiss-Prot: 68% identical to COBQ_RHOS4: Cobyric acid synthase (cobQ) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 93% identity to azl:AZL_015910)

MetaCyc: 62% identical to CobQ (Pseudomonas denitrificans (nom. rej.))
Adenosylcobyric acid synthase (glutamine-hydrolyzing). [EC: 6.3.5.10]

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>MPMX19_01025 Cobyric acid synthase (Azospirillum sp. SherDot2)
MPSQPIRSRAIMLQGTGSDVGKSLLVAGLCRALVRRGLSVRPFKPQNMSNNAAVTADGGE
IGRAQALQARACGVAPSVHMNPVLLKPQSDIGSQVVVRGVVVGTARAADYQARKRDLLGT
VLDSFERLRGEADIVVVEGAGSPAEVNLRAGDIANMGFATAADVPVMLVGDIDRGGVIAS
LVGTHALLPKSEQERIKGFLINKFRGDVRLFDEGLRIIESHTGWRGFGVVPWLREAAILP
AEDAVALDRPREAGDGALRIAVPMLSRIANFDDFDPLAQEPGVALTMVRPGQPLPGDCDL
VILPGTKATIADLAFLRAQGWDIDLMAHWRRGGRVLGICGGYQMLGRRIADPDGIEGPPG
EAAGLGLLDVETVLKGPKVLEEAHGTERRTGAAVAGYEMHMGRTEGADRARPMLELTGGG
TDGAESADGRVAGCYLHGLFTADGFRSAYLRRLGGAGSDLGYGVAVERALDAVADRLESV
VDVNGLLAVAQG