Protein Info for MPMX19_01015 in Azospirillum sp. SherDot2

Annotation: Anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF02885: Glycos_trans_3N" amino acids 10 to 71 (62 residues), 83.3 bits, see alignment E=8.4e-28 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 13 to 337 (325 residues), 402 bits, see alignment E=1.1e-124 PF00591: Glycos_transf_3" amino acids 80 to 328 (249 residues), 307.3 bits, see alignment E=9.7e-96

Best Hits

Swiss-Prot: 82% identical to TRPD_AZOBR: Anthranilate phosphoribosyltransferase (trpD) from Azospirillum brasilense

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 95% identity to azl:AZL_016010)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>MPMX19_01015 Anthranilate phosphoribosyltransferase (Azospirillum sp. SherDot2)
MSGDLSDMKAILGKVATGAALTEAEAGFAFDIIMSGNATPSQMGGFLMALRVRGETVDEI
TGAARVMRAKAIPVEAPPGTIDTCGTGGDGAGTYNISTAAALVVSSCGVPVAKHGNRAIS
SKSGAADVLGSLGVNLDCDFALVRRALWDAGIAFLMAPRHHLAMRNVGPTRVELGTRTVF
NLLGPLANPATARRQVLGVFSKQWVEPLAQVLKRLGSEAAWVVHGSDGLDEITTTGPTTV
AQLKDGEVTVFEVTPEDAGLARARIEELKGGDAQVNAEAIHALFDGVRSPYRDIVLLNAA
AALLVAGKAATLKDGVAMAADAIDSGGARDRLRRLVAITNEATA