Protein Info for MPMX19_00974 in Azospirillum sp. SherDot2

Annotation: Putative aminoacrylate hydrolase RutD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF12697: Abhydrolase_6" amino acids 46 to 239 (194 residues), 50.9 bits, see alignment E=8.5e-17 PF12146: Hydrolase_4" amino acids 60 to 232 (173 residues), 36.8 bits, see alignment E=6.6e-13 PF00561: Abhydrolase_1" amino acids 71 to 233 (163 residues), 59.8 bits, see alignment E=8.7e-20 PF08386: Abhydrolase_4" amino acids 188 to 246 (59 residues), 31 bits, see alignment E=6e-11

Best Hits

KEGG orthology group: None (inferred from 90% identity to azl:AZL_016390)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>MPMX19_00974 Putative aminoacrylate hydrolase RutD (Azospirillum sp. SherDot2)
MSPSSTHPNSTSANSGRRPALILLPGMPLDAALWDHQVRHLGEVADPQVVELADCDSIAA
MAGKVLAQAPERFAVAGLSMGGYVALEILRRAPERVERLALLDTNARPDTAEASATRREA
VALARQGRYGQVIRAALPRLIHPERLADDGFVRSVLAQMERVGVDGYAREQEAIINRVDS
RPGLAAIRCPTLVVCGRQDILTPPALHEEMAEAIPGARLVVIEECGHLSAMEQPQAVTAL
MRDWLLRD