Protein Info for MPMX19_00931 in Azospirillum sp. SherDot2

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF02353: CMAS" amino acids 110 to 377 (268 residues), 298.1 bits, see alignment E=2.8e-92 PF01728: FtsJ" amino acids 162 to 208 (47 residues), 23.5 bits, see alignment 2.2e-08 PF13489: Methyltransf_23" amino acids 162 to 281 (120 residues), 45.9 bits, see alignment E=2.4e-15 PF13847: Methyltransf_31" amino acids 168 to 275 (108 residues), 47.4 bits, see alignment E=7.7e-16 PF05175: MTS" amino acids 169 to 243 (75 residues), 23.4 bits, see alignment E=1.9e-08 PF13649: Methyltransf_25" amino acids 172 to 270 (99 residues), 71.8 bits, see alignment E=2.8e-23 PF08242: Methyltransf_12" amino acids 173 to 271 (99 residues), 51.2 bits, see alignment E=7.7e-17 PF08241: Methyltransf_11" amino acids 173 to 273 (101 residues), 53.5 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 91% identity to azl:AZL_016810)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>MPMX19_00931 Cyclopropane-fatty-acyl-phospholipid synthase (Azospirillum sp. SherDot2)
MLLVRLLAAAKGDGTLNLVTADGKHHRIGSGPPHLTLRLHDRRVERDLLINPRLRFGEAY
MDGRFSIEGGTIYDLLAMLMSGAEVQGALGRALESLSPLLRHVQQYNPMQRSRQNVEHHY
NLSRQFYQLFLDRDMQYSCAYFPEPGISLDEAQEAKKRHIAAKLLIVPGMRVLDIGCGWG
GMALYLARHTGARVTGITLSSEQLAVARQRAEEAGLADRVAFELRDYREFAAAHRGAFDR
IVSVGMFEHVGVPHYRDYFAAVREMLNDDGVALIHAIGRLDGPASTNPWIRKYIFPGGYS
PALSEVLPVIERSGLFATDLEVLRLHYAETLRHWRARFLDRWDEAKALYDERFCRMWEFY
LAGAELAFRLQGHMVFQVQVARSLGAVPLTRDYMLNAERDLAGTEASHPVERRPSRTPES
AT