Protein Info for MPMX19_00913 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 56 to 74 (19 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 52 to 493 (442 residues), 509 bits, see alignment E=5.8e-157 PF12801: Fer4_5" amino acids 113 to 153 (41 residues), 36.5 bits, see alignment 1.3e-12 PF13746: Fer4_18" amino acids 235 to 343 (109 residues), 131.2 bits, see alignment E=6.9e-42 PF11614: FixG_C" amino acids 379 to 505 (127 residues), 97.4 bits, see alignment E=2.3e-31

Best Hits

Swiss-Prot: 48% identical to RDXB_RHOS4: Protein RdxB (rdxB) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 88% identity to azl:AZL_016980)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>MPMX19_00913 hypothetical protein (Azospirillum sp. SherDot2)
MSLRQEDTPLTRRPDPAGKHAAKTHAGPQEEPGRHWFIDRPKVYAADVKGRFRQLKWAVL
IVLLAVYYITPWLRWERGPGIPDQAVLIDMVGRRAYFLWIEIWPQEVYYLTGLLILGAFG
IFFATTLAGRIWCGYACPQTVWTDLFMWVERKIEGPRTTRIRLDKAPMTGAKLARKTAKH
AAWVGISLLTGGAWVFYFNDAPTLMNELLHGEITSGVATFIALFSFTTYFFAGWAREQIC
IYVCPWRSFQSAMVDEDTFLVTYEDWRGEGRAPLRKSQGWEDRQAAGLGDCIDCKQCVHV
CPTGTDIREGQQISCIGCGLCVDACNDVMRQIGRPIDLVRFDTQSNQIAKIDGKPERVKL
VRPRTVIYSLIMLVVLCAMGIALMLRPTLDVSVLRDRAPLFVTLSDGSVQNAYTIKVLNK
THITRSYAVSFEGLRNAHLSVAGDEAAGSGGSLTLTAEADSVATFRVFVKVPAAAVKSGS
TDVAVIAKDLGSGEAGKHASVFMAP