Protein Info for MPMX19_00867 in Azospirillum sp. SherDot2

Annotation: Flagellar biosynthetic protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details TIGR00328: flagellar biosynthetic protein FlhB" amino acids 9 to 353 (345 residues), 383 bits, see alignment E=7e-119 PF01312: Bac_export_2" amino acids 9 to 348 (340 residues), 398.4 bits, see alignment E=1.4e-123

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 92% identity to azl:AZL_012110)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>MPMX19_00867 Flagellar biosynthetic protein FlhB (Azospirillum sp. SherDot2)
MSEEADESSKTEDPTGKKLDEAHKQGQFAMTREAANWLMVAAMLVVLVSILPGTMKGLVF
RLNYYFENLDRITFDRAGVGALLFRVMSDAMWALWLPILLFVVAGVMSTIGQTGFHISWE
LISPKFGKLNPLPGLMNMFKANQGVELLKSIVKLGVVGGVAYMALVPMFGGIEAYIGIDI
VAMLLQMDGLAHRLLVWVLVVLTFIAAGDFLWQKQQFDKKMKMTKQEVKDEHKQQEGDPV
VKGRIRQIRFERARKRMMAAVPNADVVVTNPTHFAVALKYDPTQMGAPMVLAKGVDQVAF
KIREIAESNNVPVIENPPLARALYAACDIDAEVPSEHYRAVAEVITYVFKLKGRSLRN