Protein Info for MPMX19_00864 in Azospirillum sp. SherDot2

Annotation: Flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 14 to 98 (85 residues), 51.7 bits, E=5.4e-18
• PF02049: FliE
  • amino acids 15 to 99 (85 residues), 76.8 bits, E=5.8e-26

Best Hits

Swiss-Prot: 36% identical to FLIE1_BRADU: Flagellar hook-basal body complex protein FliE 1 (fliE1) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 97% identity to azl:AZL_012080)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Protein Sequence (99 amino acids)

>MPMX19_00864 Flagellar hook-basal body complex protein FliE (Azospirillum sp. SherDot2)
MINPLNAAAAYATTAAKTTGPGMAARDGASFGDVLEQAAKESIGTLKKSEDISAMAAVGK
ADLNDVVQAVTNAEVTLQTVTAVRDKVLNAYQEILRMPM