Protein Info for MPMX19_00831 in Azospirillum sp. SherDot2

Annotation: GMP synthase [glutamine-hydrolyzing]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 12 to 201 (190 residues), 238.7 bits, E=3.2e-75
• PF00117: GATase
  • amino acids 13 to 197 (185 residues), 144.2 bits, E=9.6e-46
• PF07722: Peptidase_C26
  • amino acids 76 to 180 (105 residues), 32.9 bits, E=1.4e-11
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 210 to 522 (313 residues), 493 bits, E=3.7e-152
• PF02540: NAD_synthase
  • amino acids 215 to 251 (37 residues), 26.3 bits, 1e-09
• PF03054: tRNA_Me_trans
  • amino acids 226 to 259 (34 residues), 23.4 bits, see alignment (E = 1e-08)
• PF00958: GMP_synt_C
  • amino acids 430 to 521 (92 residues), 155.7 bits, E=6.5e-50

Best Hits

Swiss-Prot: 75% identical to GUAA_GLUOX: GMP synthase [glutamine-hydrolyzing] (guaA) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 99% identity to azl:AZL_011710)

MetaCyc: 57% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (522 amino acids)

>MPMX19_00831 GMP synthase [glutamine-hydrolyzing] (Azospirillum sp. SherDot2)
MSSAASLSAERVLILDFGSQVTQLIARRVRESGVYCEIHPFGMSDERIREYDPKAIILSG
SPASVTEANGPRAPQAVFDLKVPVLGICYGQQTMCHQLGGTVSGSDHREFGRAFIEIKEP
CALFDGLWDIGSKEQVWMSHGDRVTALPPGFRAVAVSDGAPFAAIADDQRRLYGVQFHPE
VVHTPHGAQLLANFVHRVAGIEGDWTMAAFKQQAIEKIRAQVGTGKVICGLSGGVDSSVA
AVLIHEAIGDQLTCIFVDTGLMRAGESEEVVRLFRDHYNIPLVHREAADLFLGKLAGVTD
PEQKRKIIGGLFIEVFDEESAKVGGAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGG
LPERMKLKLVEPLRELFKDEVRALGRELGLPPAFIGRHPFPGPGLAIRIPGEITPEKLEI
LRKADTVYLEEIRNAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDHVLALRAVTSTDGMTA
DWYPFPHDFLARVSNRIVNEVRGVNRVVYDITSKPPGTIEWE