Protein Info for MPMX19_00786 in Azospirillum sp. SherDot2

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details PF03924: CHASE" amino acids 83 to 231 (149 residues), 29.2 bits, see alignment E=1.2e-10 PF00512: HisKA" amino acids 321 to 380 (60 residues), 32.5 bits, see alignment 1.1e-11 PF02518: HATPase_c" amino acids 430 to 540 (111 residues), 84.9 bits, see alignment E=8.1e-28

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>MPMX19_00786 Adaptive-response sensory-kinase SasA (Azospirillum sp. SherDot2)
MTAQPLTAPRRPAVLRRLLAAGARIWKPAAIQAAVTLVLLVGYVWMADVYVRVLVAEHRA
TAALTASSLASTLSSALNERLALVRGLTAFVEVASGTGSLAEQFPRYAEGLRRSVVGVRT
ISAAPDFVVRIVYPMEGNEKVLGNDLLRDARPGFADTVQRAIVSRDVTVHGPVNLLQGGQ
GLIARQIVSGPGKPWGAVGLVFDVGAILNEVRFDRVPAHLGFAVVTDGGRQVAGDALALK
GDPLVERINLPDGYWHLALAPRSSWEGLAHGDPTFRGFRLAFFLLSLLIETVTFMAIGRR
HTLERQVDLRTAELGRAKNELEQFAYATAHDLQEPLRAIASYAQLLERQQKGRLDEESEG
FIREIVDGAGRLKMLLRDVQLFLAEDRVPLGCGVIPAGDPLKAALAALKRRIADAGAAVT
VAELPSVQADERRLREIFIVLIANAIEYRHPYRAAEVQISHRRVDGYDVIDVRDNGIGIE
PRYRDQIFEVFRRLHPRDEHPGTGMGLAIARKMVERLGGRLTVLSSPGVGSTFSIHLPHP
SFRGFP