Protein Info for MPMX19_00757 in Azospirillum sp. SherDot2

Annotation: Carbamoyl-phosphate synthase small chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 16 to 385 (370 residues), 465.3 bits, E=6.4e-144
• PF00988: CPSase_sm_chain
  • amino acids 17 to 142 (126 residues), 171.7 bits, E=9.2e-55
• PF00117: GATase
  • amino acids 205 to 382 (178 residues), 185 bits, E=1.9e-58
• PF07722: Peptidase_C26
  • amino acids 260 to 299 (40 residues), 21.8 bits, 2.2e-08

Best Hits

Swiss-Prot: 66% identical to CARA_BRUAB: Carbamoyl-phosphate synthase small chain (carA) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 97% identity to azl:AZL_010540)

MetaCyc: 54% identical to carbamoyl-phosphate synthetase small subunit (Escherichia coli K-12 substr. MG1655)
Carbamoyl-phosphate synthase (glutamine-hydrolyzing). [EC: 6.3.5.5]

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• allantoin degradation IV (anaerobic) (3/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Protein Sequence (390 amino acids)

>MPMX19_00757 Carbamoyl-phosphate synthase small chain (Azospirillum sp. SherDot2)
MTLATPPSDNAVHTGVLVLADGTVFRGRGIGATGDSVGEVCFNTSMTGYQEILTDPSYAG
QIITFTFPHIGNTGANLEDIETITPAARGLILRADITDPSNWRATRHLDDWLKSYGLVGL
TGIDTRRLTRRIRDLGAPNGVVAHAPDGKFDIEALVAKAKGWPGLEGMDLAKDVSCRQTY
DWTEAGWTIGGGYATLDKPQYHVVAIDYGAKRNILRCLAAAGCKVTVVPSTATVEDVMRH
QPDGVFLSNGPGDPAATGEYAVPTIKGLLDTGVPMFGICLGHQMLSLALGAKTTKMQQGH
RGANHPVKDLASGRVEITSQNHGFVVMPETLPADAEVTHVSLFDGTNEGIRLKGKPVFSV
QYHPEASPGPQDSHYLFDRFVQLIAEKKAA